![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [189739] (2 PDB entries) |
![]() | Domain d3tqwb1: 3tqw B:2-237 [217003] Other proteins in same PDB: d3tqwa2, d3tqwb2 automated match to d4ef1b_ complexed with met, so4 |
PDB Entry: 3tqw (more details), 2 Å
SCOPe Domain Sequences for d3tqwb1:
Sequence, based on SEQRES records: (download)
>d3tqwb1 c.94.1.0 (B:2-237) automated matches {Coxiella burnetii [TaxId: 777]} vrvgtiagpetqlmevakqvalnryglhvniitfsdyntpnealadgsvdanmfqhlpyl kaqiemrgykivsigktfvypmglyskkitaltqlktgakiavpsdpsnearalllleka qliqlkthvtinatpmdiasnpkklkiveldaaqlsrslgdvdlaaintnyaipaglsps rdalltegpnspyanvvavreddkndprlkqlvsalhspavlsaakkifgdgaipa
>d3tqwb1 c.94.1.0 (B:2-237) automated matches {Coxiella burnetii [TaxId: 777]} vrvgtiagpetqlmevakqvalnryglhvniitfsdyntpnealadgsvdanmfqhlpyl kaqiemrgykivsigktfvypmglyskkitaltqlktgakiavpsdpsnearalllleka qliqlktnatpmdiasnpkklkiveldaaqlsrslgdvdlaaintnyaipaglspsrdal ltegpnspyanvvavreddkndprlkqlvsalhspavlsaakkifgdgaipa
Timeline for d3tqwb1: