SCOP 1.55: Domain d1epfd1: 1epf D:-1-97

Lineage for d1epfd1 (1epf D:-1-97)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (21 proteins)

6. Protein Neural cell adhesion molecule (NCAM) [49166] (1 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [49167] (3 PDB entries)

8. Domain d1epfd1: 1epf D:-1-97 [21700]

Details for d1epfd1

PDB Entry: 1epf, 1.85 Å

PDB Description: crystal structure of the two n-terminal immunoglobulin domains of the neural cell adhesion molecule (ncam)

SCOP Domain Sequences for d1epfd1:

Sequence; same for both SEQRES and ATOM records:

>d1epfd1 b.1.1.4 (D:-1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus)}
rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
sstltiynaniddagiykcvvtaedgtqseatvnvkifq

Timeline for d1epfd1:

• d1epfd1 appears in SCOP 1.57
  
• d1epfd1 appears in the current release, SCOPe 2.08