Lineage for d3tqva1 (3tqv A:7-119)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647036Fold d.41: alpha/beta-Hammerhead [54664] (5 superfamilies)
    core: beta-BETA-alpha-beta-BETA-beta-alpha; contains a beta-hammerhead motif similar to that in barrel-sandwich hybrids
  4. 1647148Superfamily d.41.2: Nicotinate/Quinolinate PRTase N-terminal domain-like [54675] (3 families) (S)
  5. 1647220Family d.41.2.0: automated matches [227168] (1 protein)
    not a true family
  6. 1647221Protein automated matches [226878] (6 species)
    not a true protein
  7. 1647227Species Francisella tularensis [TaxId:177416] [226221] (1 PDB entry)
  8. 1647228Domain d3tqva1: 3tqv A:7-119 [216998]
    Other proteins in same PDB: d3tqva2, d3tqvb2
    automated match to d1qapa2
    complexed with po4

Details for d3tqva1

PDB Entry: 3tqv (more details), 2.62 Å

PDB Description: structure of the nicotinate-nucleotide pyrophosphorylase from francisella tularensis.
PDB Compounds: (A:) Nicotinate-nucleotide pyrophosphorylase

SCOPe Domain Sequences for d3tqva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqva1 d.41.2.0 (A:7-119) automated matches {Francisella tularensis [TaxId: 177416]}
ntdqinkvpndivtrlvreslaediatgditaqlaedidttafcitreemilcgqdfane
vinqldkniqitwlysdaqkvpanarifelkgnvrsiltaertilnfiqmlsg

SCOPe Domain Coordinates for d3tqva1:

Click to download the PDB-style file with coordinates for d3tqva1.
(The format of our PDB-style files is described here.)

Timeline for d3tqva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqva2