| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.4: ITPase-like [52972] (4 families) ![]() formerly Maf/Ham1; elaborated with additional structures inserted in the common fold |
| Family c.51.4.0: automated matches [191335] (1 protein) not a true family |
| Protein automated matches [190179] (9 species) not a true protein |
| Species Coxiella burnetii [TaxId:227377] [226205] (1 PDB entry) |
| Domain d3tqub_: 3tqu B: [216995] automated match to d2e5xa_ complexed with ca, edo |
PDB Entry: 3tqu (more details), 1.9 Å
SCOPe Domain Sequences for d3tqub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqub_ c.51.4.0 (B:) automated matches {Coxiella burnetii [TaxId: 227377]}
mleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarhaakq
tglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsasfhc
vialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqeknai
shrgqaleqlstvltea
Timeline for d3tqub_: