Lineage for d3tqub_ (3tqu B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2881870Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2882121Superfamily c.51.4: ITPase-like [52972] (4 families) (S)
    formerly Maf/Ham1; elaborated with additional structures inserted in the common fold
  5. 2882183Family c.51.4.0: automated matches [191335] (1 protein)
    not a true family
  6. 2882184Protein automated matches [190179] (9 species)
    not a true protein
  7. 2882188Species Coxiella burnetii [TaxId:227377] [226205] (1 PDB entry)
  8. 2882190Domain d3tqub_: 3tqu B: [216995]
    automated match to d2e5xa_
    complexed with ca, edo

Details for d3tqub_

PDB Entry: 3tqu (more details), 1.9 Å

PDB Description: structure of a ham1 protein from coxiella burnetii
PDB Compounds: (B:) Non-canonical purine NTP pyrophosphatase

SCOPe Domain Sequences for d3tqub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqub_ c.51.4.0 (B:) automated matches {Coxiella burnetii [TaxId: 227377]}
mleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarhaakq
tglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsasfhc
vialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqeknai
shrgqaleqlstvltea

SCOPe Domain Coordinates for d3tqub_:

Click to download the PDB-style file with coordinates for d3tqub_.
(The format of our PDB-style files is described here.)

Timeline for d3tqub_: