SCOPe 2.06: Domain d3tqua_: 3tqu A:

Lineage for d3tqua_ (3tqu A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest

4. Superfamily c.51.4: ITPase-like [52972] (4 families)
   formerly Maf/Ham1; elaborated with additional structures inserted in the common fold

5. Family c.51.4.0: automated matches [191335] (1 protein)
   not a true family

6. Protein automated matches [190179] (8 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:227377] [226205] (1 PDB entry)

8. Domain d3tqua_: 3tqu A: [216994]
   automated match to d2e5xa_
   complexed with ca, edo

Details for d3tqua_

PDB Entry: 3tqu, 1.9 Å

PDB Description: structure of a ham1 protein from coxiella burnetii

PDB Compounds: (A:) Non-canonical purine NTP pyrophosphatase

SCOPe Domain Sequences for d3tqua_:

Sequence; same for both SEQRES and ATOM records:

>d3tqua_ c.51.4.0 (A:) automated matches {Coxiella burnetii [TaxId: 227377]}
mleivlasqnssklaemqellrdleikfipqtefsvpdieetgstfvenaiikarhaakq
tglpaladdsgltiaalnsapgvfssryagknatdaeriqkvlealeaaddsdrsasfhc
vialmenendpaplichgvwegeiareprgkngfgydpifyvpshqrtaaeldpqeknai
shrgqaleqlstvltea

Timeline for d3tqua_:

• d3tqua_ first appeared in SCOPe 2.03
  
• d3tqua_ appears in SCOPe 2.05
  
• d3tqua_ appears in SCOPe 2.07
  
• d3tqua_ appears in the current release, SCOPe 2.08