SCOPe 2.05: Domain d1epfc2: 1epf C:98-189

Lineage for d1epfc2 (1epf C:98-189)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.4: I set domains [49159] (39 proteins)
Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)
Species Norway rat (Rattus norvegicus) [TaxId:10116] [49167] (4 PDB entries)
Rat and mouse sequences are identical for the two N-terminal modules
Domain d1epfc2: 1epf C:98-189 [21699]
modules 1 and 2
complexed with ca

Details for d1epfc2

PDB Entry: 1epf (more details), 1.85 Å

PDB Description: crystal structure of the two n-terminal immunoglobulin domains of the neural cell adhesion molecule (ncam)

PDB Compounds: (C:) protein (neural cell adhesion molecule)

SCOPe Domain Sequences for d1epfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epfc2 b.1.1.4 (C:98-189) Neural cell adhesion molecule (NCAM) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
klmfknaptpqefkegedavivcdvvsslpptiiwkhkgrdvilkkdvrfivlsnnylqi
rgikktdegtyrcegrilargeinfkdiqviv

SCOPe Domain Coordinates for d1epfc2:

Click to download the PDB-style file with coordinates for d1epfc2.
(The format of our PDB-style files is described here.)

Timeline for d1epfc2: