SCOPe 2.03: Domain d3tqqa2: 3tqq A:206-314

Lineage for d3tqqa2 (3tqq A:206-314)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
   barrel, open; n*=6, S*=10; greek-key

4. Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families)

5. Family b.46.1.0: automated matches [227262] (1 protein)
   not a true family

6. Protein automated matches [227053] (4 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [226216] (1 PDB entry)

8. Domain d3tqqa2: 3tqq A:206-314 [216989]
   Other proteins in same PDB: d3tqqa1
   automated match to d1fmta1
   complexed with k

Details for d3tqqa2

PDB Entry: 3tqq, 2 Å

PDB Description: structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii

PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d3tqqa2:

Sequence; same for both SEQRES and ATOM records:

>d3tqqa2 b.46.1.0 (A:206-314) automated matches {Coxiella burnetii [TaxId: 777]}
iqkqealidwrksaveiarqvrafnptpiaftyfegqpmriwratvvdektdfepgvlvd
adkkgisiaagsgilrlhqlqlpgkrvcsagdfinahgdklipgktvfg

Timeline for d3tqqa2:

• d3tqqa2 is new in SCOPe 2.03-stable
  
• d3tqqa2 appears in SCOPe 2.04
  
• d3tqqa2 appears in the current release, SCOPe 2.08