Class b: All beta proteins [48724] (174 folds) |
Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily) barrel, open; n*=6, S*=10; greek-key |
Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) |
Family b.46.1.0: automated matches [227262] (1 protein) not a true family |
Protein automated matches [227053] (4 species) not a true protein |
Species Coxiella burnetii [TaxId:777] [226216] (1 PDB entry) |
Domain d3tqqa2: 3tqq A:206-314 [216989] Other proteins in same PDB: d3tqqa1 automated match to d1fmta1 complexed with k |
PDB Entry: 3tqq (more details), 2 Å
SCOPe Domain Sequences for d3tqqa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqqa2 b.46.1.0 (A:206-314) automated matches {Coxiella burnetii [TaxId: 777]} iqkqealidwrksaveiarqvrafnptpiaftyfegqpmriwratvvdektdfepgvlvd adkkgisiaagsgilrlhqlqlpgkrvcsagdfinahgdklipgktvfg
Timeline for d3tqqa2: