![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.65: Formyltransferase [53327] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest |
![]() | Superfamily c.65.1: Formyltransferase [53328] (2 families) ![]() |
![]() | Family c.65.1.0: automated matches [191608] (1 protein) not a true family |
![]() | Protein automated matches [191110] (11 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [189726] (2 PDB entries) |
![]() | Domain d3tqqa1: 3tqq A:1-205 [216988] Other proteins in same PDB: d3tqqa2 automated match to d1fmta2 complexed with k |
PDB Entry: 3tqq (more details), 2 Å
SCOPe Domain Sequences for d3tqqa1:
Sequence, based on SEQRES records: (download)
>d3tqqa1 c.65.1.0 (A:1-205) automated matches {Coxiella burnetii [TaxId: 777]} mslkivfagtpqfavptlralidsshrvlavytqpdrpsgrgqkimespvkeiarqneip iiqpfslrdeveqekliamnadvmvvvayglilpkkalnafrlgcvnvhasllprwrgaa piqrailagdretgisimqmnegldtgdvlaksacvissedtaadlhdrlsligadllle slaklekgdiklekqdeasatyask
>d3tqqa1 c.65.1.0 (A:1-205) automated matches {Coxiella burnetii [TaxId: 777]} mslkivfagtpqfavptlralidsshrvlavytqpdespvkeiarqneipiiqpfslrde veqekliamnadvmvvvayglilpkkalnafrlgcvnvhasllprwrgaapiqrailagd retgisimqmnegldtgdvlaksacvissedtaadlhdrlsligadllleslaklekgdi klekqdeasatyask
Timeline for d3tqqa1: