Lineage for d3tqqa1 (3tqq A:1-205)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892510Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 2892511Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 2892629Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 2892630Protein automated matches [191110] (11 species)
    not a true protein
  7. 2892653Species Coxiella burnetii [TaxId:777] [189726] (2 PDB entries)
  8. 2892655Domain d3tqqa1: 3tqq A:1-205 [216988]
    Other proteins in same PDB: d3tqqa2
    automated match to d1fmta2
    complexed with k

Details for d3tqqa1

PDB Entry: 3tqq (more details), 2 Å

PDB Description: structure of the methionyl-trna formyltransferase (fmt) from coxiella burnetii
PDB Compounds: (A:) Methionyl-tRNA formyltransferase

SCOPe Domain Sequences for d3tqqa1:

Sequence, based on SEQRES records: (download)

>d3tqqa1 c.65.1.0 (A:1-205) automated matches {Coxiella burnetii [TaxId: 777]}
mslkivfagtpqfavptlralidsshrvlavytqpdrpsgrgqkimespvkeiarqneip
iiqpfslrdeveqekliamnadvmvvvayglilpkkalnafrlgcvnvhasllprwrgaa
piqrailagdretgisimqmnegldtgdvlaksacvissedtaadlhdrlsligadllle
slaklekgdiklekqdeasatyask

Sequence, based on observed residues (ATOM records): (download)

>d3tqqa1 c.65.1.0 (A:1-205) automated matches {Coxiella burnetii [TaxId: 777]}
mslkivfagtpqfavptlralidsshrvlavytqpdespvkeiarqneipiiqpfslrde
veqekliamnadvmvvvayglilpkkalnafrlgcvnvhasllprwrgaapiqrailagd
retgisimqmnegldtgdvlaksacvissedtaadlhdrlsligadllleslaklekgdi
klekqdeasatyask

SCOPe Domain Coordinates for d3tqqa1:

Click to download the PDB-style file with coordinates for d3tqqa1.
(The format of our PDB-style files is described here.)

Timeline for d3tqqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqqa2