Lineage for d3tqoa1 (3tqo A:1-316)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2105373Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2105374Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2106026Family c.26.1.0: automated matches [191377] (1 protein)
    not a true family
  6. 2106027Protein automated matches [190459] (50 species)
    not a true protein
  7. 2106072Species Coxiella burnetii [TaxId:777] [226213] (1 PDB entry)
  8. 2106073Domain d3tqoa1: 3tqo A:1-316 [216982]
    Other proteins in same PDB: d3tqoa2, d3tqoa3
    automated match to d1u0bb2
    complexed with zn

Details for d3tqoa1

PDB Entry: 3tqo (more details), 2.3 Å

PDB Description: structure of the cysteinyl-trna synthetase (cyss) from coxiella burnetii.
PDB Compounds: (A:) cysteinyl-tRNA synthetase

SCOPe Domain Sequences for d3tqoa1:

Sequence, based on SEQRES records: (download)

>d3tqoa1 c.26.1.0 (A:1-316) automated matches {Coxiella burnetii [TaxId: 777]}
msvkifnsltkqkeifkpiesgkvklyvcgmtvydymhighgrswiifdmvvrylrmrgy
evtfvrnitdiddkiikragenkespaalaerfiqilhedekalrvlspdqepratqyvp
eiikliqklldnqyaytgqngdvffdvrrfkdygklshrhldelqagarvevsdskrdpl
dfvlwkkakpgepkwdspwgegrpgwhiecsamsssilgqpfdihgggldlkfphhenei
aqseageekpfvklwmhaglleinkekmskslgniisirealkesdvevlryfllsghyr
nplsyskenlengrla

Sequence, based on observed residues (ATOM records): (download)

>d3tqoa1 c.26.1.0 (A:1-316) automated matches {Coxiella burnetii [TaxId: 777]}
msvkifnsltkqkeifkpiesgkvklyvcgmtvydymhighgrswiifdmvvrylrmrgy
evtfvrnitdiddkiikragenkespaalaerfiqilhedekalrvlspdqepratqyvp
eiikliqklldnqyaytgqngdvffdvrrfkdygklshrhldskrdpldfvlwkkakpge
pkwdspwgegrpgwhiecsamsssilgqpfdihgggldlkfphheneiaqseageekpfv
klwmhaglleinkekmskslgniisirealkesdvevlryfllsghyrnplsyskenlen
grla

SCOPe Domain Coordinates for d3tqoa1:

Click to download the PDB-style file with coordinates for d3tqoa1.
(The format of our PDB-style files is described here.)

Timeline for d3tqoa1: