Lineage for d3tqmb_ (3tqm B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3006182Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
    beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest
  4. 3006183Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) (S)
    automatically mapped to Pfam PF02482
  5. 3006200Family d.204.1.0: automated matches [227270] (1 protein)
    not a true family
  6. 3006201Protein automated matches [227070] (6 species)
    not a true protein
  7. 3006202Species Coxiella burnetii [TaxId:777] [226215] (1 PDB entry)
  8. 3006204Domain d3tqmb_: 3tqm B: [216979]
    automated match to d3v2ey_
    complexed with so4

Details for d3tqmb_

PDB Entry: 3tqm (more details), 2.45 Å

PDB Description: structure of an ribosomal subunit interface protein from coxiella burnetii
PDB Compounds: (B:) Ribosome-associated factor Y

SCOPe Domain Sequences for d3tqmb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqmb_ d.204.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]}
mhiqmtgqgvdispalreltekklhriqpcrdeisnihiifhinklkkivdanvklpgst
inaqaesddmyktvdllmhkletqlskykakk

SCOPe Domain Coordinates for d3tqmb_:

Click to download the PDB-style file with coordinates for d3tqmb_.
(The format of our PDB-style files is described here.)

Timeline for d3tqmb_: