![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily) beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest |
![]() | Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families) ![]() automatically mapped to Pfam PF02482 |
![]() | Family d.204.1.0: automated matches [227270] (1 protein) not a true family |
![]() | Protein automated matches [227070] (6 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [226215] (1 PDB entry) |
![]() | Domain d3tqmb_: 3tqm B: [216979] automated match to d3v2ey_ complexed with so4 |
PDB Entry: 3tqm (more details), 2.45 Å
SCOPe Domain Sequences for d3tqmb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqmb_ d.204.1.0 (B:) automated matches {Coxiella burnetii [TaxId: 777]} mhiqmtgqgvdispalreltekklhriqpcrdeisnihiifhinklkkivdanvklpgst inaqaesddmyktvdllmhkletqlskykakk
Timeline for d3tqmb_: