SCOPe 2.05: Domain d3tqma_: 3tqm A:

Lineage for d3tqma_ (3tqm A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.204: Ribosome binding protein Y (YfiA homologue) [69753] (1 superfamily)
   beta-alpha-beta(3)-alpha; 2 layers; mixed sheet 1234, strand 3 is antiparallel to the rest

4. Superfamily d.204.1: Ribosome binding protein Y (YfiA homologue) [69754] (2 families)
   automatically mapped to Pfam PF02482

5. Family d.204.1.0: automated matches [227270] (1 protein)
   not a true family

6. Protein automated matches [227070] (4 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [226215] (1 PDB entry)

8. Domain d3tqma_: 3tqm A: [216978]
   automated match to d3v2ey_
   complexed with so4

Details for d3tqma_

PDB Entry: 3tqm, 2.45 Å

PDB Description: structure of an ribosomal subunit interface protein from coxiella burnetii

PDB Compounds: (A:) Ribosome-associated factor Y

SCOPe Domain Sequences for d3tqma_:

Sequence; same for both SEQRES and ATOM records:

>d3tqma_ d.204.1.0 (A:) automated matches {Coxiella burnetii [TaxId: 777]}
mhiqmtgqgvdispalreltekklhriqpcrdeisnihiifhinklkkivdanvklpgst
inaqaesddmyktvdllmhkletqlskykak

Timeline for d3tqma_:

• d3tqma_ first appeared in SCOPe 2.03
  
• d3tqma_ appears in SCOPe 2.04
  
• d3tqma_ appears in SCOPe 2.06
  
• d3tqma_ appears in the current release, SCOPe 2.08