SCOPe 2.07: Domain d3tqjb2: 3tqj B:84-193

Lineage for d3tqjb2 (3tqj B:84-193)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (37 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [226207] (1 PDB entry)

8. Domain d3tqjb2: 3tqj B:84-193 [216977]
   Other proteins in same PDB: d3tqja1, d3tqjb1
   automated match to d1kkca2
   complexed with fe2

Details for d3tqjb2

PDB Entry: 3tqj, 2 Å

PDB Description: structure of the superoxide dismutase (fe) (sodb) from coxiella burnetii

PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3tqjb2:

Sequence; same for both SEQRES and ATOM records:

>d3tqjb2 d.44.1.0 (B:84-193) automated matches {Coxiella burnetii [TaxId: 777]}
dgggdpsgelasaidktfgslekfkalftdsannhfgsgwawlvkdnngklevlstvnar
npmtegkkplmtcdvwehayyidtrndrpkyvnnfwqvvnwdfvmknfks

Timeline for d3tqjb2:

• d3tqjb2 first appeared in SCOPe 2.03
  
• d3tqjb2 appears in SCOPe 2.06
  
• d3tqjb2 appears in the current release, SCOPe 2.08