![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily) alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213 |
![]() | Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) ![]() automatically mapped to Pfam PF02777 |
![]() | Family d.44.1.0: automated matches [227155] (1 protein) not a true family |
![]() | Protein automated matches [226860] (30 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [226207] (1 PDB entry) |
![]() | Domain d3tqjb2: 3tqj B:84-193 [216977] Other proteins in same PDB: d3tqja1, d3tqjb1 automated match to d1kkca2 complexed with fe2 |
PDB Entry: 3tqj (more details), 2 Å
SCOPe Domain Sequences for d3tqjb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqjb2 d.44.1.0 (B:84-193) automated matches {Coxiella burnetii [TaxId: 777]} dgggdpsgelasaidktfgslekfkalftdsannhfgsgwawlvkdnngklevlstvnar npmtegkkplmtcdvwehayyidtrndrpkyvnnfwqvvnwdfvmknfks
Timeline for d3tqjb2: