Lineage for d3tqjb2 (3tqj B:84-193)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1903583Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 1903584Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families) (S)
    automatically mapped to Pfam PF02777
  5. 1903858Family d.44.1.0: automated matches [227155] (1 protein)
    not a true family
  6. 1903859Protein automated matches [226860] (30 species)
    not a true protein
  7. 1903927Species Coxiella burnetii [TaxId:777] [226207] (1 PDB entry)
  8. 1903929Domain d3tqjb2: 3tqj B:84-193 [216977]
    Other proteins in same PDB: d3tqja1, d3tqjb1
    automated match to d1kkca2
    complexed with fe2

Details for d3tqjb2

PDB Entry: 3tqj (more details), 2 Å

PDB Description: structure of the superoxide dismutase (fe) (sodb) from coxiella burnetii
PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3tqjb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqjb2 d.44.1.0 (B:84-193) automated matches {Coxiella burnetii [TaxId: 777]}
dgggdpsgelasaidktfgslekfkalftdsannhfgsgwawlvkdnngklevlstvnar
npmtegkkplmtcdvwehayyidtrndrpkyvnnfwqvvnwdfvmknfks

SCOPe Domain Coordinates for d3tqjb2:

Click to download the PDB-style file with coordinates for d3tqjb2.
(The format of our PDB-style files is described here.)

Timeline for d3tqjb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqjb1