Lineage for d3tqjb1 (3tqj B:2-83)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2689745Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 2690049Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) (S)
    automatically mapped to Pfam PF00081
  5. 2690339Family a.2.11.0: automated matches [227154] (1 protein)
    not a true family
  6. 2690340Protein automated matches [226859] (39 species)
    not a true protein
  7. 2690419Species Coxiella burnetii [TaxId:777] [226206] (1 PDB entry)
  8. 2690421Domain d3tqjb1: 3tqj B:2-83 [216976]
    Other proteins in same PDB: d3tqja2, d3tqjb2
    automated match to d1kkca1
    complexed with fe2

Details for d3tqjb1

PDB Entry: 3tqj (more details), 2 Å

PDB Description: structure of the superoxide dismutase (fe) (sodb) from coxiella burnetii
PDB Compounds: (B:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3tqjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tqjb1 a.2.11.0 (B:2-83) automated matches {Coxiella burnetii [TaxId: 777]}
afelpdlpyklnalephisqetleyhhgkhhrayvnklnkliegtpfekepleeiirksd
ggifnnaaqhwnhtfywhcmsp

SCOPe Domain Coordinates for d3tqjb1:

Click to download the PDB-style file with coordinates for d3tqjb1.
(The format of our PDB-style files is described here.)

Timeline for d3tqjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tqjb2