SCOPe 2.08: Domain d3tqja2: 3tqj A:84-193

Lineage for d3tqja2 (3tqj A:84-193)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.0: automated matches [227155] (1 protein)
   not a true family

6. Protein automated matches [226860] (38 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [226207] (1 PDB entry)

8. Domain d3tqja2: 3tqj A:84-193 [216975]
   Other proteins in same PDB: d3tqja1, d3tqjb1
   automated match to d1kkca2
   complexed with fe2

Details for d3tqja2

PDB Entry: 3tqj, 2 Å

PDB Description: structure of the superoxide dismutase (fe) (sodb) from coxiella burnetii

PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3tqja2:

Sequence; same for both SEQRES and ATOM records:

>d3tqja2 d.44.1.0 (A:84-193) automated matches {Coxiella burnetii [TaxId: 777]}
dgggdpsgelasaidktfgslekfkalftdsannhfgsgwawlvkdnngklevlstvnar
npmtegkkplmtcdvwehayyidtrndrpkyvnnfwqvvnwdfvmknfks

Timeline for d3tqja2:

• d3tqja2 first appeared in SCOPe 2.03
  
• d3tqja2 appears in SCOPe 2.07