![]() | Class a: All alpha proteins [46456] (286 folds) |
![]() | Fold a.2: Long alpha-hairpin [46556] (20 superfamilies) 2 helices; antiparallel hairpin, left-handed twist |
![]() | Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families) ![]() automatically mapped to Pfam PF00081 |
![]() | Family a.2.11.0: automated matches [227154] (1 protein) not a true family |
![]() | Protein automated matches [226859] (31 species) not a true protein |
![]() | Species Coxiella burnetii [TaxId:777] [226206] (1 PDB entry) |
![]() | Domain d3tqja1: 3tqj A:2-83 [216974] Other proteins in same PDB: d3tqja2, d3tqjb2 automated match to d1kkca1 complexed with fe2 |
PDB Entry: 3tqj (more details), 2 Å
SCOPe Domain Sequences for d3tqja1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tqja1 a.2.11.0 (A:2-83) automated matches {Coxiella burnetii [TaxId: 777]} afelpdlpyklnalephisqetleyhhgkhhrayvnklnkliegtpfekepleeiirksd ggifnnaaqhwnhtfywhcmsp
Timeline for d3tqja1: