SCOPe 2.03: Domain d3tqja1: 3tqj A:2-83

Lineage for d3tqja1 (3tqj A:2-83)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
   2 helices; antiparallel hairpin, left-handed twist

4. Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (2 families)
   automatically mapped to Pfam PF00081

5. Family a.2.11.0: automated matches [227154] (1 protein)
   not a true family

6. Protein automated matches [226859] (26 species)
   not a true protein

7. Species Coxiella burnetii [TaxId:777] [226206] (1 PDB entry)

8. Domain d3tqja1: 3tqj A:2-83 [216974]
   Other proteins in same PDB: d3tqja2, d3tqjb2
   automated match to d1kkca1
   complexed with fe2

Details for d3tqja1

PDB Entry: 3tqj, 2 Å

PDB Description: structure of the superoxide dismutase (fe) (sodb) from coxiella burnetii

PDB Compounds: (A:) superoxide dismutase [fe]

SCOPe Domain Sequences for d3tqja1:

Sequence; same for both SEQRES and ATOM records:

>d3tqja1 a.2.11.0 (A:2-83) automated matches {Coxiella burnetii [TaxId: 777]}
afelpdlpyklnalephisqetleyhhgkhhrayvnklnkliegtpfekepleeiirksd
ggifnnaaqhwnhtfywhcmsp

Timeline for d3tqja1:

• d3tqja1 is new in SCOPe 2.03-stable
  
• d3tqja1 appears in SCOPe 2.04
  
• d3tqja1 appears in the current release, SCOPe 2.08