Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (22 species) not a true protein |
Species Campylobacter jejuni [TaxId:192222] [226204] (1 PDB entry) |
Domain d3tpfd2: 3tpf D:143-303 [216962] Other proteins in same PDB: d3tpfb3 automated match to d1pvva2 complexed with peg |
PDB Entry: 3tpf (more details), 2.7 Å
SCOPe Domain Sequences for d3tpfd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tpfd2 c.78.1.0 (D:143-303) automated matches {Campylobacter jejuni [TaxId: 192222]} ngiakvafigdsnnmcnswlitaailgfeisiampknykispeiwefamkqalisgakis lgydkfealkdkdvvitdtwvsmgeenekerkikefegfmidekamsvankdaillhclp ayrgyevseeifekhadvifeearnrlyvvkallcfldnqr
Timeline for d3tpfd2: