SCOPe 2.08: Domain d3tpfc2: 3tpf C:143-303

Lineage for d3tpfc2 (3tpf C:143-303)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Campylobacter jejuni [TaxId:192222] [226204] (1 PDB entry)

8. Domain d3tpfc2: 3tpf C:143-303 [216960]
   Other proteins in same PDB: d3tpfb3
   automated match to d1pvva2
   complexed with peg

Details for d3tpfc2

PDB Entry: 3tpf, 2.7 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from campylobacter jejuni subsp. jejuni nctc 11168

PDB Compounds: (C:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d3tpfc2:

Sequence, based on SEQRES records:

>d3tpfc2 c.78.1.0 (C:143-303) automated matches {Campylobacter jejuni [TaxId: 192222]}
ngiakvafigdsnnmcnswlitaailgfeisiampknykispeiwefamkqalisgakis
lgydkfealkdkdvvitdtwvsmgeenekerkikefegfmidekamsvankdaillhclp
ayrgyevseeifekhadvifeearnrlyvvkallcfldnqr

Sequence, based on observed residues (ATOM records):

>d3tpfc2 c.78.1.0 (C:143-303) automated matches {Campylobacter jejuni [TaxId: 192222]}
ngiakvafigdsnnmcnswlitaailgfeisiampknykispeiwefamkqalisgakis
lgydkfealkdkdvvitdtwvsmgeekerkikefegfmidekamsvankdaillhclpay
rgyevseeifekhadvifeearnrlyvvkallcfldnqr

Timeline for d3tpfc2:

• d3tpfc2 first appeared in SCOPe 2.03
  
• d3tpfc2 appears in SCOPe 2.07