Lineage for d1epfb1 (1epf B:-1-97)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54443Protein Neural cell adhesion molecule (NCAM) [49166] (2 species)
  7. 54446Species Rat (Rattus norvegicus) [TaxId:10116] [49167] (3 PDB entries)
  8. 54449Domain d1epfb1: 1epf B:-1-97 [21696]

Details for d1epfb1

PDB Entry: 1epf (more details), 1.85 Å

PDB Description: crystal structure of the two n-terminal immunoglobulin domains of the neural cell adhesion molecule (ncam)

SCOP Domain Sequences for d1epfb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1epfb1 b.1.1.4 (B:-1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus)}
rvlqvdivpsqgeisvgeskfflcqvagdakdkdiswfspngeklspnqqrisvvwnddd
sstltiynaniddagiykcvvtaedgtqseatvnvkifq

SCOP Domain Coordinates for d1epfb1:

Click to download the PDB-style file with coordinates for d1epfb1.
(The format of our PDB-style files is described here.)

Timeline for d1epfb1: