Lineage for d3tpfc1 (3tpf C:1-142)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2906931Species Campylobacter jejuni [TaxId:192222] [226204] (1 PDB entry)
  8. 2906936Domain d3tpfc1: 3tpf C:1-142 [216959]
    Other proteins in same PDB: d3tpfb3
    automated match to d1pvva1
    complexed with peg

Details for d3tpfc1

PDB Entry: 3tpf (more details), 2.7 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from campylobacter jejuni subsp. jejuni nctc 11168
PDB Compounds: (C:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d3tpfc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tpfc1 c.78.1.0 (C:1-142) automated matches {Campylobacter jejuni [TaxId: 192222]}
mkhfltlrdfskeeilslvnhaselkkepkkllqdktlamifeknstrtrmafelaitel
ggkalflssndlqlsrgepvkdtarvigamvdfvmmrvnkhetllefaryskapvinals
elyhptqvlgdlftikewnkmq

SCOPe Domain Coordinates for d3tpfc1:

Click to download the PDB-style file with coordinates for d3tpfc1.
(The format of our PDB-style files is described here.)

Timeline for d3tpfc1: