Lineage for d3tpcg_ (3tpc G:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848327Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226212] (3 PDB entries)
  8. 2848342Domain d3tpcg_: 3tpc G: [216953]
    automated match to d3ay6a_

Details for d3tpcg_

PDB Entry: 3tpc (more details), 2.34 Å

PDB Description: crystal structure of a hypothtical protein sma1452 from sinorhizobium meliloti 1021
PDB Compounds: (G:) Short chain alcohol dehydrogenase-related dehydrogenase

SCOPe Domain Sequences for d3tpcg_:

Sequence, based on SEQRES records: (download)

>d3tpcg_ c.2.1.0 (G:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
lksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrnadvtn
eadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmi
rlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarf
girvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentmlnge
virldgalrm

Sequence, based on observed residues (ATOM records): (download)

>d3tpcg_ c.2.1.0 (G:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
lksrvfivtgassglgaavtrmlaqegatvlgldlkvrfrnadvtneadataalafakqe
fghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqgepda
dgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgifdt
pasvpfpprlgraeeyaalvkhicentmlngevirldgalrm

SCOPe Domain Coordinates for d3tpcg_:

Click to download the PDB-style file with coordinates for d3tpcg_.
(The format of our PDB-style files is described here.)

Timeline for d3tpcg_: