SCOPe 2.06: Domain d3tpcd_: 3tpc D:

Lineage for d3tpcd_ (3tpc D:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (239 species)
   not a true protein

7. Species Rhizobium meliloti (Sinorhizobium meliloti) [TaxId:382] [226212] (3 PDB entries)

8. Domain d3tpcd_: 3tpc D: [216950]
   automated match to d3ay6a_

Details for d3tpcd_

PDB Entry: 3tpc, 2.34 Å

PDB Description: crystal structure of a hypothtical protein sma1452 from sinorhizobium meliloti 1021

PDB Compounds: (D:) Short chain alcohol dehydrogenase-related dehydrogenase

SCOPe Domain Sequences for d3tpcd_:

Sequence, based on SEQRES records:

>d3tpcd_ c.2.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
qlksrvfivtgassglgaavtrmlaqegatvlgldlkppageepaaelgaavrfrnadvt
neadataalafakqefghvhglvncagtapgekilgrsgphaldsfartvavnligtfnm
irlaaevmsqgepdadgergvivntasiaafdgqigqaayaaskggvaaltlpaarelar
fgirvvtiapgifdtpmmagmpqdvqdalaasvpfpprlgraeeyaalvkhicentmlng
evirldgalrm

Sequence, based on observed residues (ATOM records):

>d3tpcd_ c.2.1.0 (D:) automated matches {Rhizobium meliloti (Sinorhizobium meliloti) [TaxId: 382]}
qlksrvfivtgassglgaavtrmlaqegatvlgldlkppvrfrnadvtneadataalafa
kqefghvhglvncagtapgekilgrsgphaldsfartvavnligtfnmirlaaevmsqge
pdadgergvivntasiaafdgqigqaayaaskggvaaltlpaarelarfgirvvtiapgi
fdtpaasvpfpprlgraeeyaalvkhicentmlngevirldgalrm

Timeline for d3tpcd_:

• d3tpcd_ first appeared in SCOPe 2.03
  
• d3tpcd_ appears in SCOPe 2.05
  
• d3tpcd_ appears in SCOPe 2.07
  
• d3tpcd_ appears in the current release, SCOPe 2.08