Lineage for d3tp0a2 (3tp0 A:97-214)
- Root: SCOPe 2.08
Class a: All alpha proteins [46456] (290 folds) 
Fold a.121: Tetracyclin repressor-like, C-terminal domain [48497] (1 superfamily)
multihelical; interlocked (homo)dimerSuperfamily a.121.1: Tetracyclin repressor-like, C-terminal domain [48498] (2 families) 
Family a.121.1.1: Tetracyclin repressor-like, C-terminal domain [48499] (35 proteins) 
Protein Ethr repressor [109978] (2 species) Species Mycobacterium tuberculosis [TaxId:1773] [109979] (65 PDB entries)
Uniprot P96222 22-215
Domain d3tp0a2: 3tp0 A:97-214 [216945]
Other proteins in same PDB: d3tp0a1
automated match to d1t56a2
protein/DNA complex; complexed with fo5
Details for d3tp0a2
PDB Entry: 3tp0 (more details), 1.9 Å
PDB Description: structural activation of the transcriptional repressor ethr from m. tuberculosis by single amino-acid change mimicking natural and synthetic ligands
PDB Compounds: (A:) HTH-type transcriptional regulator EthRSCOPe Domain Sequences for d3tp0a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tp0a2 a.121.1.1 (A:97-214) Ethr repressor {Mycobacterium tuberculosis [TaxId: 1773]}
tdrenmwrtginvffetfgshkavtragqaaratsvevaelwstfmqkwiaytaavidae
rdrgaaprtlpahelatalnlmnertlfasfageqpsvpearvldtlvhiwvtsiyge
SCOPe Domain Coordinates for d3tp0a2:
Click to download the PDB-style file with coordinates for d3tp0a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d3tp0a2:
- d3tp0a2 first appeared in SCOPe 2.03
- d3tp0a2 appears in SCOPe 2.07
View in 3D
