![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (203 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:169963] [226203] (3 PDB entries) |
![]() | Domain d3tozh2: 3toz H:113-291 [216943] Other proteins in same PDB: d3toza1, d3tozb1, d3tozc1, d3tozd1, d3toze1, d3tozf1, d3tozg1, d3tozh1 automated match to d1vi2b1 complexed with cl, nad, so4 |
PDB Entry: 3toz (more details), 2.2 Å
SCOPe Domain Sequences for d3tozh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tozh2 c.2.1.0 (H:113-291) automated matches {Listeria monocytogenes [TaxId: 169963]} dgtgymralkeaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaek tvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpe livsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf
Timeline for d3tozh2: