Lineage for d3tozc1 (3toz C:5-112)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2890282Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 2890283Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) (S)
  5. 2890629Family c.58.1.0: automated matches [227157] (1 protein)
    not a true family
  6. 2890630Protein automated matches [226864] (40 species)
    not a true protein
  7. 2890791Species Listeria monocytogenes [TaxId:169963] [226202] (2 PDB entries)
  8. 2890798Domain d3tozc1: 3toz C:5-112 [216932]
    Other proteins in same PDB: d3toza2, d3tozb2, d3tozc2, d3tozd2, d3toze2, d3tozf2, d3tozg2, d3tozh2
    automated match to d1npda2
    complexed with cl, nad, so4

Details for d3tozc1

PDB Entry: 3toz (more details), 2.2 Å

PDB Description: 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with nad.
PDB Compounds: (C:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3tozc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tozc1 c.58.1.0 (C:5-112) automated matches {Listeria monocytogenes [TaxId: 169963]}
iteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgfra
mnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghit

SCOPe Domain Coordinates for d3tozc1:

Click to download the PDB-style file with coordinates for d3tozc1.
(The format of our PDB-style files is described here.)

Timeline for d3tozc1: