![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
![]() | Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
![]() | Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
![]() | Protein automated matches [226864] (40 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:169963] [226202] (2 PDB entries) |
![]() | Domain d3tozc1: 3toz C:5-112 [216932] Other proteins in same PDB: d3toza2, d3tozb2, d3tozc2, d3tozd2, d3toze2, d3tozf2, d3tozg2, d3tozh2 automated match to d1npda2 complexed with cl, nad, so4 |
PDB Entry: 3toz (more details), 2.2 Å
SCOPe Domain Sequences for d3tozc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tozc1 c.58.1.0 (C:5-112) automated matches {Listeria monocytogenes [TaxId: 169963]} iteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgfra mnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghit
Timeline for d3tozc1: