SCOPe 2.08: Domain d3tozb1: 3toz B:2-112

Lineage for d3tozb1 (3toz B:2-112)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [226202] (2 PDB entries)

8. Domain d3tozb1: 3toz B:2-112 [216930]
   Other proteins in same PDB: d3toza2, d3tozb2, d3tozc2, d3tozd2, d3toze2, d3tozf2, d3tozg2, d3tozh2
   automated match to d1npda2
   complexed with cl, nad, so4

Details for d3tozb1

PDB Entry: 3toz, 2.2 Å

PDB Description: 2.2 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with nad.

PDB Compounds: (B:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3tozb1:

Sequence; same for both SEQRES and ATOM records:

>d3tozb1 c.58.1.0 (B:2-112) automated matches {Listeria monocytogenes [TaxId: 169963]}
tnkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqg
framnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghit

Timeline for d3tozb1:

• d3tozb1 first appeared in SCOPe 2.03
  
• d3tozb1 appears in SCOPe 2.07