SCOPe 2.07: Domain d1zxqa2: 1zxq A:1-86

Lineage for d1zxqa2 (1zxq A:1-86)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Intercellular adhesion molecule-2, ICAM-2 [49164] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49165] (1 PDB entry)

8. Domain d1zxqa2: 1zxq A:1-86 [21693]
   Other proteins in same PDB: d1zxqa1
   D1

Details for d1zxqa2

PDB Entry: 1zxq, 2.2 Å

PDB Description: the crystal structure of icam-2

PDB Compounds: (A:) intercellular adhesion molecule-2

SCOPe Domain Sequences for d1zxqa2:

Sequence; same for both SEQRES and ATOM records:

>d1zxqa2 b.1.1.4 (A:1-86) Intercellular adhesion molecule-2, ICAM-2 {Human (Homo sapiens) [TaxId: 9606]}
kvfevhvrpkklavepkgslevncsttcnqpevggletslnkilldeqaqwkhylvsnis
hdtvlqchftcsgkqesmnsnvsvyq

Timeline for d1zxqa2:

• d1zxqa2 first appeared (with stable ids) in SCOP 1.55, called d1zxq_2
  
• d1zxqa2 appears in SCOPe 2.06
  
• d1zxqa2 appears in the current release, SCOPe 2.08