Lineage for d1zxq_2 (1zxq 1-86)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 54281Family b.1.1.4: I set domains [49159] (22 proteins)
  6. 54433Protein N-terminal domain of intracellular adhesion molecule-2, ICAM-2 [49164] (1 species)
  7. 54434Species Human (Homo sapiens) [TaxId:9606] [49165] (1 PDB entry)
  8. 54435Domain d1zxq_2: 1zxq 1-86 [21693]
    Other proteins in same PDB: d1zxq_1

Details for d1zxq_2

PDB Entry: 1zxq (more details), 2.2 Å

PDB Description: the crystal structure of icam-2

SCOP Domain Sequences for d1zxq_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxq_2 b.1.1.4 (1-86) N-terminal domain of intracellular adhesion molecule-2, ICAM-2 {Human (Homo sapiens)}
kvfevhvrpkklavepkgslevncsttcnqpevggletslnkilldeqaqwkhylvsnis
hdtvlqchftcsgkqesmnsnvsvyq

SCOP Domain Coordinates for d1zxq_2:

Click to download the PDB-style file with coordinates for d1zxq_2.
(The format of our PDB-style files is described here.)

Timeline for d1zxq_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zxq_1