Lineage for d1zxq_2 (1zxq 1-86)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.4: I set domains [49159] (21 proteins) 
Protein N-terminal domain of intracellular adhesion molecule-2, ICAM-2 [49164] (1 species) Species Human (Homo sapiens) [TaxId:9606] [49165] (1 PDB entry) 
Domain d1zxq_2: 1zxq 1-86 [21693]
Other proteins in same PDB: d1zxq_1
Details for d1zxq_2
PDB Entry: 1zxq (more details), 2.2 Å
PDB Description: the crystal structure of icam-2
SCOP Domain Sequences for d1zxq_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zxq_2 b.1.1.4 (1-86) N-terminal domain of intracellular adhesion molecule-2, ICAM-2 {Human (Homo sapiens)}
kvfevhvrpkklavepkgslevncsttcnqpevggletslnkilldeqaqwkhylvsnis
hdtvlqchftcsgkqesmnsnvsvyq
SCOP Domain Coordinates for d1zxq_2:
Click to download the PDB-style file with coordinates for d1zxq_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1zxq_2:
- d1zxq_2 appears in SCOP 1.57
- d1zxq_2 appears in the current release, SCOPe 2.08, called d1zxqa2
View in 3D
