Lineage for d1zxqa2 (1zxq A:1-86)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2753554Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2753789Protein Intercellular adhesion molecule-2, ICAM-2 [49164] (1 species)
  7. 2753790Species Human (Homo sapiens) [TaxId:9606] [49165] (1 PDB entry)
  8. 2753791Domain d1zxqa2: 1zxq A:1-86 [21693]
    Other proteins in same PDB: d1zxqa1
    D1

Details for d1zxqa2

PDB Entry: 1zxq (more details), 2.2 Å

PDB Description: the crystal structure of icam-2
PDB Compounds: (A:) intercellular adhesion molecule-2

SCOPe Domain Sequences for d1zxqa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxqa2 b.1.1.4 (A:1-86) Intercellular adhesion molecule-2, ICAM-2 {Human (Homo sapiens) [TaxId: 9606]}
kvfevhvrpkklavepkgslevncsttcnqpevggletslnkilldeqaqwkhylvsnis
hdtvlqchftcsgkqesmnsnvsvyq

SCOPe Domain Coordinates for d1zxqa2:

Click to download the PDB-style file with coordinates for d1zxqa2.
(The format of our PDB-style files is described here.)

Timeline for d1zxqa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zxqa1