SCOP 1.55: Domain d1d3la2: 1d3l A:1-82

Lineage for d1d3la2 (1d3l A:1-82)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (21 proteins)

6. Protein N-terminal domain of intracellular adhesion molecule-1, ICAM-1 [49162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49163] (3 PDB entries)

8. Domain d1d3la2: 1d3l A:1-82 [21692]
   Other proteins in same PDB: d1d3la1

Details for d1d3la2

PDB Entry: 1d3l, 3.25 Å

PDB Description: d1d2-icam-1 fully glycosylated, variation of d1-d2 interdomain angle in different crystal structures.

SCOP Domain Sequences for d1d3la2:

Sequence; same for both SEQRES and ATOM records:

>d1d3la2 b.1.1.4 (A:1-82) N-terminal domain of intracellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens)}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

SCOP Domain Coordinates for d1d3la2 are not available.

Timeline for d1d3la2:

• d1d3la2 appears in SCOP 1.57
  
• d1d3la2 appears in the current release, SCOPe 2.08