Lineage for d3toma_ (3tom A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311322Superfamily a.24.3: Cytochromes [47175] (3 families) (S)
    Heme-containing proteins
  5. 2311323Family a.24.3.1: Cytochrome b562 [47176] (2 protein domains)
    automatically mapped to Pfam PF07361
  6. 2311324Protein Cytochrome b562 [47177] (1 species)
  7. 2311325Species Escherichia coli [TaxId:562] [47178] (42 PDB entries)
  8. 2311379Domain d3toma_: 3tom A: [216916]
    automated match to d3tolc_
    complexed with hem, zn

Details for d3toma_

PDB Entry: 3tom (more details), 2.3 Å

PDB Description: Crystal structure of an engineered cytochrome cb562 that forms 2D, Zn-mediated sheets
PDB Compounds: (A:) Soluble cytochrome b562

SCOPe Domain Sequences for d3toma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3toma_ a.24.3.1 (A:) Cytochrome b562 {Escherichia coli [TaxId: 562]}
adlednmetlndnlkviekadnaaqvekalekmlaaaadalkatppkledkspdspemrd
frhgfailmgqihdaahlanegkvkeaqaaaeqlkttcnachqkyr

SCOPe Domain Coordinates for d3toma_:

Click to download the PDB-style file with coordinates for d3toma_.
(The format of our PDB-style files is described here.)

Timeline for d3toma_: