Lineage for d1ic1b2 (1ic1 B:1-82)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 104725Family b.1.1.4: I set domains [49159] (25 proteins)
  6. 104881Protein N-terminal domain of intracellular adhesion molecule-1, ICAM-1 [49162] (1 species)
  7. 104882Species Human (Homo sapiens) [TaxId:9606] [49163] (3 PDB entries)
  8. 104885Domain d1ic1b2: 1ic1 B:1-82 [21691]
    Other proteins in same PDB: d1ic1a1, d1ic1b1

Details for d1ic1b2

PDB Entry: 1ic1 (more details), 3 Å

PDB Description: the crystal structure for the n-terminal two domains of icam-1

SCOP Domain Sequences for d1ic1b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ic1b2 b.1.1.4 (B:1-82) N-terminal domain of intracellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens)}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

SCOP Domain Coordinates for d1ic1b2:

Click to download the PDB-style file with coordinates for d1ic1b2.
(The format of our PDB-style files is described here.)

Timeline for d1ic1b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ic1b1