Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (22 proteins) |
Protein N-terminal domain of intracellular adhesion molecule-1, ICAM-1 [49162] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49163] (3 PDB entries) |
Domain d1ic1b2: 1ic1 B:1-82 [21691] Other proteins in same PDB: d1ic1a1, d1ic1b1 |
PDB Entry: 1ic1 (more details), 3 Å
SCOP Domain Sequences for d1ic1b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ic1b2 b.1.1.4 (B:1-82) N-terminal domain of intracellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens)} qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed sqpmcysncpdgqstaktfltv
Timeline for d1ic1b2: