SCOPe 2.08: Domain d3tnwb1: 3tnw B:176-308

Lineage for d3tnwb1 (3tnw B:176-308)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein automated matches [227027] (3 species)
   not a true protein

7. Species Cow (Bos taurus) [TaxId:9913] [226306] (7 PDB entries)

8. Domain d3tnwb1: 3tnw B:176-308 [216908]
   Other proteins in same PDB: d3tnwa1, d3tnwa2, d3tnwc_
   automated match to d3ddqb1
   complexed with f18, na

Details for d3tnwb1

PDB Entry: 3tnw, 2 Å

PDB Description: Structure of CDK2/cyclin A in complex with CAN508

PDB Compounds: (B:) Cyclin-A2

SCOPe Domain Sequences for d3tnwb1:

Sequence; same for both SEQRES and ATOM records:

>d3tnwb1 a.74.1.1 (B:176-308) automated matches {Cow (Bos taurus) [TaxId: 9913]}
pdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhla
vnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrme
hlvlkvlafdlaa

Timeline for d3tnwb1:

• d3tnwb1 first appeared in SCOPe 2.03
  
• d3tnwb1 appears in SCOPe 2.07