Lineage for d3tnob_ (3tno B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2085156Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2086456Family c.1.10.0: automated matches [191319] (1 protein)
    not a true family
  6. 2086457Protein automated matches [190115] (75 species)
    not a true protein
  7. 2086670Species Francisella tularensis [TaxId:177416] [189018] (3 PDB entries)
  8. 2086674Domain d3tnob_: 3tno B: [216905]
    automated match to d3igxb_
    complexed with cl, i22

Details for d3tnob_

PDB Entry: 3tno (more details), 1.65 Å

PDB Description: 1.65 angstrom resolution crystal structure of transaldolase b (tala) from francisella tularensis in covalent complex with sedoheptulose-7- phosphate
PDB Compounds: (B:) Transaldolase

SCOPe Domain Sequences for d3tnob_:

Sequence, based on SEQRES records: (download)

>d3tnob_ c.1.10.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
mqksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskv
kannpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriia
ryesngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvsp
fvgritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqvial
agcdaltispvlleelknrdehlevkltknddvvtqspqiseadfrwlmnenamathkla
egirlftkdtieleniikqnl

Sequence, based on observed residues (ATOM records): (download)

>d3tnob_ c.1.10.0 (B:) automated matches {Francisella tularensis [TaxId: 177416]}
mqksvleqlkqvtmvvadtgdfelikkykpvdattnpslilkavkeqkysnlvaetiskv
kannpdlnsddlvkeiaieilvsfgikildviegkvssevdarvsfnsattidyakriia
ryesngipkdrvlikiaatwegikaakllqkegincnltlifdkaqakacaeagvylvsp
fvgritdwqmqqnnlktfpaiadddgvnsvkaiyklykshgfktivmgasfrnveqvial
agcdaltispvlleelknrdehlevkltkntqspqiseadfrwlmnenamathklaegir
lftkdtieleniikqnl

SCOPe Domain Coordinates for d3tnob_:

Click to download the PDB-style file with coordinates for d3tnob_.
(The format of our PDB-style files is described here.)

Timeline for d3tnob_: