Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49163] (7 PDB entries) |
Domain d1ic1a2: 1ic1 A:1-82 [21690] Other proteins in same PDB: d1ic1a1, d1ic1b1 D1 complexed with nag |
PDB Entry: 1ic1 (more details), 3 Å
SCOPe Domain Sequences for d1ic1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ic1a2 b.1.1.4 (A:1-82) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed sqpmcysncpdgqstaktfltv
Timeline for d1ic1a2: