SCOP 1.61: Domain d1ic1a2: 1ic1 A:1-82

Lineage for d1ic1a2 (1ic1 A:1-82)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.4: I set domains [49159] (25 proteins)

6. Protein N-terminal domain of intracellular adhesion molecule-1, ICAM-1 [49162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49163] (3 PDB entries)

8. Domain d1ic1a2: 1ic1 A:1-82 [21690]
   Other proteins in same PDB: d1ic1a1, d1ic1b1

Details for d1ic1a2

PDB Entry: 1ic1, 3 Å

PDB Description: the crystal structure for the n-terminal two domains of icam-1

SCOP Domain Sequences for d1ic1a2:

Sequence; same for both SEQRES and ATOM records:

>d1ic1a2 b.1.1.4 (A:1-82) N-terminal domain of intracellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens)}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

Timeline for d1ic1a2:

• d1ic1a2 first appeared (with stable ids) in SCOP 1.55
  
• d1ic1a2 appears in SCOP 1.59
  
• d1ic1a2 appears in SCOP 1.63
  
• d1ic1a2 appears in the current release, SCOPe 2.08