![]() | Class b: All beta proteins [48724] (104 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (22 proteins) |
![]() | Protein N-terminal domain of intracellular adhesion molecule-1, ICAM-1 [49162] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [49163] (3 PDB entries) |
![]() | Domain d1iam_2: 1iam 1-82 [21689] Other proteins in same PDB: d1iam_1 |
PDB Entry: 1iam (more details), 2.1 Å
SCOP Domain Sequences for d1iam_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iam_2 b.1.1.4 (1-82) N-terminal domain of intracellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens)} qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed sqpmcysncpdgqstaktfltv
Timeline for d1iam_2: