SCOP 1.55: Domain d1iam_2: 1iam 1-82

Lineage for d1iam_2 (1iam 1-82)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (21 proteins)

6. Protein N-terminal domain of intracellular adhesion molecule-1, ICAM-1 [49162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49163] (3 PDB entries)

8. Domain d1iam_2: 1iam 1-82 [21689]
   Other proteins in same PDB: d1iam_1

Details for d1iam_2

PDB Entry: 1iam, 2.1 Å

PDB Description: structure of the two amino-terminal domains of human intercellular adhesion molecule-1, icam-1

SCOP Domain Sequences for d1iam_2:

Sequence; same for both SEQRES and ATOM records:

>d1iam_2 b.1.1.4 (1-82) N-terminal domain of intracellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens)}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

Timeline for d1iam_2:

• d1iam_2 appears in SCOP 1.57
  
• d1iam_2 appears in the current release, SCOPe 2.08, called d1iama2