SCOPe 2.08: Domain d1iama2: 1iam A:1-82

Lineage for d1iama2 (1iam A:1-82)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.4: I set domains [49159] (39 proteins)

6. Protein Intercellular adhesion molecule-1, ICAM-1 [49162] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49163] (6 PDB entries)

8. Domain d1iama2: 1iam A:1-82 [21689]
   Other proteins in same PDB: d1iama1
   D1
   complexed with nag

Details for d1iama2

PDB Entry: 1iam, 2.1 Å

PDB Description: structure of the two amino-terminal domains of human intercellular adhesion molecule-1, icam-1

PDB Compounds: (A:) intercellular adhesion molecule-1

SCOPe Domain Sequences for d1iama2:

Sequence; same for both SEQRES and ATOM records:

>d1iama2 b.1.1.4 (A:1-82) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]}
qtsvspskvilprggsvlvtcstscdqpkllgietplpkkelllpgnnrkvyelsnvqed
sqpmcysncpdgqstaktfltv

Timeline for d1iama2:

• d1iama2 first appeared (with stable ids) in SCOP 1.55, called d1iam_2
  
• d1iama2 appears in SCOPe 2.07