| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) ![]() |
| Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
| Protein automated matches [226864] (40 species) not a true protein |
| Species Listeria monocytogenes [TaxId:169963] [226202] (2 PDB entries) |
| Domain d3tnlc1: 3tnl C:3-112 [216888] Other proteins in same PDB: d3tnla2, d3tnlb2, d3tnlc2, d3tnld2 automated match to d1npda2 complexed with cl, nad, skm |
PDB Entry: 3tnl (more details), 1.45 Å
SCOPe Domain Sequences for d3tnlc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tnlc1 c.58.1.0 (C:3-112) automated matches {Listeria monocytogenes [TaxId: 169963]}
nkiteritghteligliatpirhslsptmhneafaklgldyvylafevgdkelkdvvqgf
ramnlrgwnvsmpnktnihkyldklspaaelvgavntvvnddgvltghit
Timeline for d3tnlc1: