Lineage for d3tnlb2 (3tnl B:113-291)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847491Species Listeria monocytogenes [TaxId:169963] [226203] (3 PDB entries)
  8. 2847493Domain d3tnlb2: 3tnl B:113-291 [216887]
    Other proteins in same PDB: d3tnla1, d3tnlb1, d3tnlc1, d3tnld1
    automated match to d1vi2b1
    complexed with cl, nad, skm

Details for d3tnlb2

PDB Entry: 3tnl (more details), 1.45 Å

PDB Description: 1.45 angstrom crystal structure of shikimate 5-dehydrogenase from listeria monocytogenes in complex with shikimate and nad.
PDB Compounds: (B:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3tnlb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tnlb2 c.2.1.0 (B:113-291) automated matches {Listeria monocytogenes [TaxId: 169963]}
dgtgymralkeaghdiigkkmticgaggaataiciqaaldgvkeisifnrkddfyanaek
tvekinsktdckaqlfdiedheqlrkeiaesviftnatgvgmkpfegetllpsadmlrpe
livsdvvykptktrlleiaeeqgcqtlnglgmmlwqgakafeiwthkempvdyikeilf

SCOPe Domain Coordinates for d3tnlb2:

Click to download the PDB-style file with coordinates for d3tnlb2.
(The format of our PDB-style files is described here.)

Timeline for d3tnlb2: