Lineage for d3tn8a_ (3tn8 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2586062Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2586063Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2586210Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2586917Protein Cell division protein kinase 9, CDK9 [160810] (1 species)
  7. 2586918Species Human (Homo sapiens) [TaxId:9606] [160811] (6 PDB entries)
    Uniprot P50750 8-325
  8. 2586923Domain d3tn8a_: 3tn8 A: [216881]
    Other proteins in same PDB: d3tn8b1, d3tn8b2
    automated match to d3blha1
    complexed with f18, gol, po4

Details for d3tn8a_

PDB Entry: 3tn8 (more details), 2.95 Å

PDB Description: CDK9/cyclin T in complex with CAN508
PDB Compounds: (A:) Cyclin-dependent kinase 9

SCOPe Domain Sequences for d3tn8a_:

Sequence, based on SEQRES records: (download)

>d3tn8a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtkaspynrckgsiylvfdfcehdlagllsnvlvkftlseik
rvmqmllnglyyihrnkilhrdmkaanvlitrdgvlkladfglarafslaknsqpnrytn
rvvtlwyrppelllgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgs
itpevwpnvdnyelyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsd
dalnhdffwsdpmpsdlk

Sequence, based on observed residues (ATOM records): (download)

>d3tn8a_ d.144.1.7 (A:) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]}
vecpfcdevskyeklakigqgtfgevfkarhrktgqkvalkkvlmenekegfpitalrei
kilqllkhenvvnlieicrtgsiylvfdfcehdlagllsnvlvkftlseikrvmqmllng
lyyihrnkilhrdmkaanvlitrdgvlkladfglarafslqpnrytnrvvtlwyrppell
lgerdygppidlwgagcimaemwtrspimqgnteqhqlalisqlcgsitpevwpnvdnye
lyeklelvkgqkrkvkdrlkayvrdpyaldlidkllvldpaqridsddalnhdffwsdpm
psdlk

SCOPe Domain Coordinates for d3tn8a_:

Click to download the PDB-style file with coordinates for d3tn8a_.
(The format of our PDB-style files is described here.)

Timeline for d3tn8a_: