Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Thermococcus sibiricus [TaxId:604354] [189611] (2 PDB entries) |
Domain d3tn7b_: 3tn7 B: [216880] automated match to d3p19d_ complexed with gol, njp |
PDB Entry: 3tn7 (more details), 1.68 Å
SCOPe Domain Sequences for d3tn7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tn7b_ c.2.1.0 (B:) automated matches {Thermococcus sibiricus [TaxId: 604354]} mkvavitgasrgigeaiaralardgyalalgarsvdrlekiahelmqeqgvevfyhhldv skaesveefskkvlerfgdvdvvvanaglgyfkrleelseeefhemievnllgvwrtlka fldslkrtgglalvttsdvsarlipygggyvstkwaaralvrtfqienpdvrffelrpga vdtyfggskpgkpkekgylkpdeiaeavrcllklpkdvrveelmlrsvyqrpey
Timeline for d3tn7b_: