SCOPe 2.03: Domain d3tl6f_: 3tl6 F:

Lineage for d3tl6f_ (3tl6 F:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.0: automated matches [191488] (1 protein)
   not a true family

6. Protein automated matches [190781] (23 species)
   not a true protein

7. Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [189769] (2 PDB entries)

8. Domain d3tl6f_: 3tl6 F: [216872]
   automated match to d3u40a_
   complexed with so4

Details for d3tl6f_

PDB Entry: 3tl6, 2.65 Å

PDB Description: Crystal structure of purine nucleoside phosphorylase from Entamoeba histolytica

PDB Compounds: (F:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3tl6f_:

Sequence, based on SEQRES records:

>d3tl6f_ c.56.2.0 (F:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv
klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf
erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl
avemeaaalymiaararkqalcmltisdlcygsgekmtaeerrtkftqmmevalsla

Sequence, based on observed residues (ATOM records):

>d3tl6f_ c.56.2.0 (F:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]}
maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv
klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf
erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl
avemeaaalymiaararkqalcmltisdlcftqmmevalsla

Timeline for d3tl6f_:

• d3tl6f_ is new in SCOPe 2.03-stable
  
• d3tl6f_ appears in SCOPe 2.04
  
• d3tl6f_ appears in the current release, SCOPe 2.08