![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies) core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops |
![]() | Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) ![]() complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8 |
![]() | Family c.56.2.0: automated matches [191488] (1 protein) not a true family |
![]() | Protein automated matches [190781] (46 species) not a true protein |
![]() | Species Entamoeba (Entamoeba histolytica) [TaxId:5759] [189769] (2 PDB entries) |
![]() | Domain d3tl6f_: 3tl6 F: [216872] Other proteins in same PDB: d3tl6d2 automated match to d3u40a_ complexed with so4 |
PDB Entry: 3tl6 (more details), 2.65 Å
SCOPe Domain Sequences for d3tl6f_:
Sequence, based on SEQRES records: (download)
>d3tl6f_ c.56.2.0 (F:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl avemeaaalymiaararkqalcmltisdlcygsgekmtaeerrtkftqmmevalsla
>d3tl6f_ c.56.2.0 (F:) automated matches {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} maehcptphngakygeiaetvlmagdplrvklladtyltdvvqynsvrgavgytgyykgv klsvqahgmgmpsigiyayelfnfygvkriirigsagafdeslklgdivigmgacydsnf erqydipgkysciadfqlcreavdaaeklgyrykvgniysanyfyddgdhsgawkkmgvl avemeaaalymiaararkqalcmltisdlcftqmmevalsla
Timeline for d3tl6f_: