Lineage for d3tl2a2 (3tl2 A:148-312)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1938734Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
    unusual fold, defines family
  4. 1938735Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families) (S)
  5. 1939262Family d.162.1.0: automated matches [227146] (1 protein)
    not a true family
  6. 1939263Protein automated matches [226850] (26 species)
    not a true protein
  7. 1939269Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226201] (1 PDB entry)
  8. 1939270Domain d3tl2a2: 3tl2 A:148-312 [216866]
    Other proteins in same PDB: d3tl2a1
    automated match to d1i0za2
    complexed with edo, scn

Details for d3tl2a2

PDB Entry: 3tl2 (more details), 1.7 Å

PDB Description: crystal structure of bacillus anthracis str. ames malate dehydrogenase in closed conformation.
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d3tl2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tl2a2 d.162.1.0 (A:148-312) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
qsgvldtarfrtfiaqelnlsvkditgfvlgghgddmvplvrysyaggipletlipkerl
eaivertrkgggeivgllgngsayyapaaslvemteailkdqrrvlpaiaylegeygysd
lylgvpvilggngiekiielelladekealdrsvesvrnvmkvlv

SCOPe Domain Coordinates for d3tl2a2:

Click to download the PDB-style file with coordinates for d3tl2a2.
(The format of our PDB-style files is described here.)

Timeline for d3tl2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3tl2a1