SCOPe 2.05: Domain d3tl2a2: 3tl2 A:148-312

Lineage for d3tl2a2 (3tl2 A:148-312)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.0: automated matches [227146] (1 protein)
   not a true family

6. Protein automated matches [226850] (26 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226201] (1 PDB entry)

8. Domain d3tl2a2: 3tl2 A:148-312 [216866]
   Other proteins in same PDB: d3tl2a1
   automated match to d1i0za2
   complexed with edo, scn

Details for d3tl2a2

PDB Entry: 3tl2, 1.7 Å

PDB Description: crystal structure of bacillus anthracis str. ames malate dehydrogenase in closed conformation.

PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d3tl2a2:

Sequence; same for both SEQRES and ATOM records:

>d3tl2a2 d.162.1.0 (A:148-312) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
qsgvldtarfrtfiaqelnlsvkditgfvlgghgddmvplvrysyaggipletlipkerl
eaivertrkgggeivgllgngsayyapaaslvemteailkdqrrvlpaiaylegeygysd
lylgvpvilggngiekiielelladekealdrsvesvrnvmkvlv

Timeline for d3tl2a2:

• d3tl2a2 first appeared in SCOPe 2.03
  
• d3tl2a2 appears in SCOPe 2.04
  
• d3tl2a2 appears in SCOPe 2.06
  
• d3tl2a2 appears in the current release, SCOPe 2.07