![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (203 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [196222] (2 PDB entries) |
![]() | Domain d3tl2a1: 3tl2 A:1-147 [216865] Other proteins in same PDB: d3tl2a2 automated match to d1i0za1 complexed with edo, scn |
PDB Entry: 3tl2 (more details), 1.7 Å
SCOPe Domain Sequences for d3tl2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3tl2a1 c.2.1.0 (A:1-147) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} mtikrkkvsvigagftgattafllaqkeladvvlvdipqlenptkgkaldmleaspvqgf daniigtsdyadtadsdvvvitagiarkpgmsrddlvatnskimksitrdiakhspnaii vvltnpvdamtysvfkeagfpkervig
Timeline for d3tl2a1: